Computer-aided formation of the whole-cell patch-clamp recording configuration.
نویسندگان
چکیده
The conventional patch-clamp technique requires well-trained experimenter. Few commercial automated patch-clamp systems, designed for drug development, are better suited for large-scale research then for standard electrophysiological experiments. Here we describe a state machine for automated recognition of recording states of the patch-clamp experiment. The principle of the state machine is based on evaluation of the charge carried by membrane current during specific time segments in responses to square wave voltage stimulation. The state machine may serve for generating various sound alerts, signals for automated control of other devices, assistance in micromanipulation, internal pipette pressure control, and holding potential adjustments. Algorithm of the state machine, designed to cover wide variety of cell types, was successfully tested on rat ventricular myocytes.
منابع مشابه
P 17: Electrophysiological Effects of Cannabinoid Receptor Antagonist AM251 on Harmaline Toxicity in Rat’s Cerebellar Vermis Slices
Introduction: The Cannabinoid receptors (CBR) densities are high within the cerebellum. Cannabinoid receptors manipulations have been reported to cause altering the cerebellar functions. harmaline have immune-modulatory effects in several studies. i.e., significant anti-inflammatory effect via the inhibition of prostaglandin E2 (PGE2) and tumor necrosis factor alpha (TNF-α). Endocannabino...
متن کاملP 18: Alterations of Electrophysiological Activity of Cerebellar Pukinje Cells of Rats Under Harmaline Toxicity
Introduction: Beta-carboline alkaloids of P. harmala are shown to have immune-modulatory effects in several studies. Extracts of this plant have significant anti-inflammatory effect via the inhibition of some inflammatory mediators including PGE2 and TNF-α. In postmortem studies, structural alterations to the cerebellum have been recognized, including Purkinje cell loss being re...
متن کاملThe interpretation of current-clamp recordings in the cell-attached patch-clamp configuration.
In these experiments we have investigated the feasibility and accuracy of recording steady-state and dynamic changes in transmembrane potential noninvasively across an intact cell-attached patch using the current-clamp mode of a conventional patch-clamp amplifier. Using an equivalent circuit mimicking simultaneous whole-cell voltage-clamp and cell-attached current-clamp recordings we have defin...
متن کاملMechanistic insight into CM18-Tat11 peptide membrane-perturbing action by whole-cell patch-clamp recording.
The membrane-destabilization properties of the recently-introduced endosomolytic CM18-Tat11 hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1-7 of cecropin-A, 2-12 of melittin, and 47-57 of HIV-1 Tat protein) are investigated in CHO-K1 cells by using the whole-cell configuration of the patch-clamp technique. CM18-Tat11, CM18, and Tat11 peptides are administered to the cell membrane wit...
متن کاملThe Touch and Zap Method for In Vivo Whole-Cell Patch Recording of Intrinsic and Visual Responses of Cortical Neurons and Glial Cells
Whole-cell patch recording is an essential tool for quantitatively establishing the biophysics of brain function, particularly in vivo. This method is of particular interest for studying the functional roles of cortical glial cells in the intact brain, which cannot be assessed with extracellular recordings. Nevertheless, a reasonable success rate remains a challenge because of stability, record...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید
ثبت ناماگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید
ورودعنوان ژورنال:
- General physiology and biophysics
دوره 24 3 شماره
صفحات -
تاریخ انتشار 2005